SIB BLAST network server version 1.6 of November 26, 2002 compiled by GNU C version 3.2.3 20030502 (Red Hat Linux 3.2.3-49) compiled on Feb 1 2005. Welcome to the SIB BLAST Network Service (noko01) ============================================================================== Swiss Institute of Bioinformatics (SIB) Ludwig Institute for Cancer Research (LICR) Swiss Institute for Experimental Cancer Research (ISREC) ============================================================================== If results of this search are reported or published, please mention that the computation was performed at the SIB using the BLAST network service. PEPTIDE SEQUENCE DATABASES swiss SwissProt + updates 14-Jul-2004 swisstrembl SwissProt+Trembl+TrUpdates 14-Jul-2004 nr Non-redundant SP+Trembl+TrUpdates+gp 14-Jul-2004 shuffled SwissProt r30 shuffled in windows of 20 aa yeast S.cerevisiae translated genome ORFs NUCLEOTIDE SEQUENCE DATABASES embre * EMBL Data Library, Release 79, June 2004 embu * EmblUpdate 14-Jul-2004 embl * EMBL+EmblUpdate 14-Jul-2004 nr * Synonym to embl (and actually redundant). 14-Jul-2004 EST Database of Expressed Sequence Tags 14-Jul-2004 GSS Genome Survey Sequences 14-Jul-2004 HTG High-thruput Genomic Sequences 14-Jul-2004 STS Database of Sequence Tagged Sites 14-Jul-2004 repbase Repbase, August 04, 2002 simple Simple sequence repeats (J. Mol. Evol. 40:120, 1995) yeast S.cerevisiae genome worm C.elegans genome * The est, gss, htg, and sts divisions of EMBL are excluded from these databases. ============================================================================ The BLAST Network Service uses a server developed at SIB and the NCBI BLAST 2 software. For problems regarding this site, please contact one of the following persons: - problems with the programs: Christian Iseli (Christian.Iseli@licr.org) Giovanna Ambrosini (giovanna.ambrosini@isb-sib.ch) - problems with the databases: Victor Jongeneel (Victor.Jongeneel@isb-sib.ch) Laurent Falquet (Laurent.Falquet@isrec.unil.ch) ============================================================================ BLASTP 2.2.10 [Oct-19-2004] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= consensus (92 letters) Database: /export/scratch/database/MYHITS2/ens.14 473,687 sequences; 222,839,780 total letters [blastpgp] WARNING: posFindAlignmentDimensions: Attempting to recover data from multiple alignment file [blastpgp] WARNING: posProcessAlignment: Alignment recovered successfully Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ens:ENSANGP00000026139 >ENSANGP00000026139 pep:known chromosome:... 130 7e-31 ens:ENSANGP00000029628 >ENSANGP00000029628 pep:novel chromosome:... 119 1e-27 ens:ENSANGP00000028602 >ENSANGP00000028602 pep:novel chromosome:... 91 7e-19 ens:ENSAPMP00000006155 >ENSAPMP00000006155 pep:novel group:AMEL2... 40 9e-04 >ens:ENSANGP00000026139 >ENSANGP00000026139 pep:known chromosome:MOZ2a:UNKN:38348707:38352374:-1 gene:ENSANGG00000024890 transcript:ENSANGT00000028479 . Length = 1221 Score = 130 bits (327), Expect = 7e-31 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 1/92 (1%) Query: 1 IRYAAPVWAEALDLQECRRLLRRVQRPLAIRVASAFRTVSYETAVVLAGLLPICLLVDED 60 IRYAAPVW++A DLQ CRR L +VQRPLA V S+F +V+YET VVLAGL+P LLV ED Sbjct: 793 IRYAAPVWSDATDLQWCRRKLAQVQRPLARGVTSSFVSVAYETGVVLAGLVPFRLLVRED 852 Query: 61 ARCYQR-RAATGSSRAVIRKEERQATMEEWQQ 91 RC++R AA G+SR IR EERQ T++EWQ+ Sbjct: 853 VRCHRRLLAAPGASRKDIRLEERQRTLQEWQR 884 >ens:ENSANGP00000029628 >ENSANGP00000029628 pep:novel chromosome:MOZ2a:2L:20230358:20232037:1 gene:ENSANGG00000023513 transcript:ENSANGT00000028124 . Length = 559 Score = 119 bits (298), Expect = 1e-27 Identities = 51/93 (54%), Positives = 65/93 (69%), Gaps = 1/93 (1%) Query: 1 IRYAAPVWAEALDLQECRRLLRRVQRPLAIRVASAFRTVSYETAVVLAGLLPICLLVDED 60 IRY AP+W EA + Q C R+L QR LA RV S FR++SY AV++AGL+P L+ ED Sbjct: 169 IRYGAPIWVEATERQWCLRMLASAQRHLAQRVVSGFRSMSYSVAVLMAGLIPHHHLIRED 228 Query: 61 ARCYQRRAA-TGSSRAVIRKEERQATMEEWQQE 92 ARC+QR A T +SR VIR+EER T+ WQ+E Sbjct: 229 ARCHQRYLADTEASRVVIRREERAVTLAAWQRE 261 >ens:ENSANGP00000028602 >ENSANGP00000028602 pep:novel chromosome:MOZ2a:UNKN:38533022:38537263:1 gene:ENSANGG00000022764 transcript:ENSANGT00000025837 . Length = 267 Score = 90.5 bits (224), Expect = 7e-19 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Query: 1 IRYAAPVWAE-ALDLQECRRLLRRVQRPLAIRVASAFRTVSYETAVVLAGLLPICLLVDE 59 IRY W LD + R+ ++R RP A+R+ SAF+TVSY+ V+A + LL+ E Sbjct: 149 IRYGVATWGRWVLDKETHRKSVQRAHRPGALRITSAFQTVSYDAVCVVANTTRLVLLMQE 208 Query: 60 DARCYQRRAATG 71 D RC+ + TG Sbjct: 209 DIRCHDDKLLTG 220 >ens:ENSAPMP00000006155 >ENSAPMP00000006155 pep:novel group:AMEL2.0:GroupUn:83229573:83231179:1 gene:ENSAPMG00000003505 transcript:ENSAPMT00000006155 . Length = 496 Score = 40.1 bits (93), Expect = 9e-04 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 11/89 (12%) Query: 3 YAAPVWAEALDLQECRRLLRRVQRPLAIRVASAFRTVSYETAVVLAGLLPICLLVDEDAR 62 YAA W + L+ R+L + QRPL I++ A+RT S + V+A + I L + E Sbjct: 362 YAAASWCDKLNKSGL-RILEQAQRPL-IKITKAYRTTSADALPVVAVVPAIVLKIKEQRA 419 Query: 63 CYQRRAATGSSRAVIRKEERQATMEEWQQ 91 + + +E R A + EWQ+ Sbjct: 420 MH--------ICNNL-QEARMALLAEWQR 439 Database: /export/scratch/database/MYHITS2/ens.14 Posted date: May 21, 2005 10:04 AM Number of letters in database: 222,839,780 Number of sequences in database: 473,687 Lambda K H 0.313 0.170 0.526 Lambda K H 0.267 0.0511 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,700,085 Number of Sequences: 473687 Number of extensions: 2854960 Number of successful extensions: 10535 Number of sequences better than 1.0: 10 Number of HSP's better than 1.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 10525 Number of HSP's gapped (non-prelim): 11 length of query: 92 length of database: 16,252,624 effective HSP length: 22 effective length of query: 70 effective length of database: 16,252,624 effective search space: 1137683680 effective search space used: 1137683680 T: 11 A: 40 X1: 15 ( 6.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (20.6 bits) S2: 67 (30.1 bits)